PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G067300.1
Common NameB456_010G067300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 346aa    MW: 37804.2 Da    PI: 7.1198
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G067300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.41.8e-29140195156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+p+LH+rFv+a++ LGG+++ t k+i+elmkv+gLt+++vkSHLQkYRl+
  Gorai.010G067300.1 140 KARRCWSPDLHKRFVNALQMLGGHQVSTTKQIRELMKVEGLTNDEVKSHLQKYRLH 195
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.4E-15138198IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-26138198IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23140195IPR006447Myb domain, plants
PfamPF002491.6E-5142193IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MASSPYELTL DCKPLTSYSM ILKSFGDQQM NDQTQKLEHV LSRLEEERLK IDAFKRELPL  60
CMQLLTNDRN SSSSCASPAL QPLPDLTFAS ISKDMEENKC SKAENDNSGK AGNGGLLIEQ  120
GKGSSNTIDG QTTISQPHRK ARRCWSPDLH KRFVNALQML GGHQVSTTKQ IRELMKVEGL  180
TNDEVKSHLQ KYRLHTRRPS LSPQPAGPQR PSLIATAVAN TNSAALTLYG AHHHPAAPHF  240
PPHFCASPVP QEFYTATTIA TPALSQRLLH HQLHLGPIHN HSSPESDING AGNHSESIED  300
NKSESGSWKG ESGDNGSDRD QRKGLAALTF GEGEESNGCD ITLKF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6051728e-41JX605172.1 Gossypium hirsutum clone NBRI_GE44715 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447737.13e-96PREDICTED: transcription activator GLK2-like
TrEMBLA0A0D2SNS70.0A0A0D2SNS7_G
STRINGPOPTR_0018s06410.12e-85(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.18e-39G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]